Protein coding transcript 64372

• Transcript: Ll_transcript_438084
• CDS coordinates: 121-1008 (+)
• Peptide sequence: MQVVNRQQGHMFFLYGYGGTGKTHMWRTLTFALRSQKHIVLTVASSGIASLLLPSGRTTHSKFKIPVPTFDNSVCNIHQGSELADLLKQTKLIIWDEAPMSHKYCFEALDKSLGDIMGTTTNDSILFRGKVVVFGGDFRQILPVIPRGCPSDIVHATINASYLWHQCTVLTLTKNMRLQNHDNARDIRQFSEWILKMGDGKLYEPNDGSVEVDIPEELLILDYDNPIDAIVSSTYPNLQDHHYNDEQFLQCRAILASTIEIVDEINEYVLSKIPGNEKEYLSSDSVDMSDANESKA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_438084

• Blastp: ATP-dependent DNA helicase pif1 from Psychrobacter with 29.89% of identity
• Blastx: ATP-dependent DNA helicase pif1 from Psychrobacter with 29.89% of identity
• Eggnog: exodeoxyribonuclease v alpha(COG0507)
• Kegg: Link to kegg annotations (PsycPRwf_1560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434840.1)
• Pfam: PIF1-like helicase (PF05970.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;