Protein coding transcript 64425

• Transcript: Ll_transcript_436573
• CDS coordinates: 786-1202 (+)
• Peptide sequence: MDSMLLGSFPKPFSFTIGGNFGRRKTSVVNHYASSYAPTVSWHKRKIQKEHNFLRFQQLSLNNPYKGIKGGSTCQGCNRKYVVKAASEQSFESESRGLDPKNIWDSVKNSLDVFYRFSRPHTVIGTVKSKLFWNNSWN*
• ORF Type: complete

Annotations of Ll_transcript_436573

• Blastp: Glycinol 4-dimethylallyltransferase from Soja with 53.91% of identity
• Blastx: Glycinol 4-dimethylallyltransferase from Soja with 48.07% of identity
• Eggnog: Synthesis of 3-octaprenyl-4-hydroxybenzoate (By similarity)(COG0382)
• Kegg: Link to kegg annotations (100301896)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454430.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;