Protein coding transcript 64430

• Transcript: Ll_transcript_436551
• CDS coordinates: 2272-2916 (+)
• Peptide sequence: MEAVVAALFMNIYIVGLNQLYDVEIDKVNKPYLPLASGEYSFHTGVLIVASFSIMSFWLGWVVGSWPLFWALFISFVLGTAYSIDVPLLRWKRFAVLAAMCILAIRAVVVQLAFFLHMQTYVYKRPAVFSRPLIFATAFMSFFSVVIALFKDIPDIEGDKIFDIQSFSVRLGQKKVFWICVSLLEMAYGVALLMGAASPCLWSKIVTVSCLLSV*
• ORF Type: complete

Annotations of Ll_transcript_436551

• Blastp: Homogentisate phytyltransferase 1, chloroplastic from Arabidopsis with 79.81% of identity
• Blastx: Homogentisate phytyltransferase 1, chloroplastic from Arabidopsis with 74.64% of identity
• Eggnog: Synthesis of 3-octaprenyl-4-hydroxybenzoate (By similarity)(COG0382)
• Kegg: Link to kegg annotations (AT2G18950)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454438.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;