Transcript | Ll_transcript_436552 |
---|---|
CDS coordinates | 2840-3322 (+) |
Peptide sequence | MSFWLGWVVGSWPLFWALFISFVLGTAYSIDVPLLRWKRFAVLAAMCILAIRAVVVQLAFFLHMQTYVYKRPAVFSRPLIFATAFMSFFSVVIALFKDIPDIEGDKIFDIQSFSVRLGQKKVFWICVSLLEMAYGVALLMGAASPCLWSKIVTVSCLLSV* |
ORF Type | complete |
Blastp | Homogentisate phytyltransferase 1, chloroplastic from Arabidopsis with 77.27% of identity |
---|---|
Blastx | Homogentisate phytyltransferase 1, chloroplastic from Arabidopsis with 78.02% of identity |
Eggnog | Synthesis of 3-octaprenyl-4-hydroxybenzoate (By similarity)(COG0382) |
Kegg | Link to kegg annotations (AT2G18950) |
CantataDB | - |
Mirbase | gma-MIR5761a (MI0019702) |
Ncbi protein | Link to NCBI protein (XP_019454430.1) |
Pfam | UbiA prenyltransferase family (PF01040.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer