Protein coding transcript 64432

• Transcript: Ll_transcript_436553
• CDS coordinates: 323-1000 (+)
• Peptide sequence: MDSVFLGSFPKSSSFTIGSYAPTASLHKRKIQTEHNILRFQQLSLNHLSKGIKGGSTCQGYNRKYVVKAASEQPFESESQALVPKSIWDNVKNSLDTFYRFSRPHTIIGTALSIISVSLLAVEKVSDLSPLFFTGVLEAVVAALFMNIYIVGLNQLSDIEIDKINKPYLPLASGEYSFQTGVIIVASFSILSFWLGWIVGSWPLLWALFISFVLGTAYSINVNSF*
• ORF Type: complete

Annotations of Ll_transcript_436553

• Blastp: Homogentisate phytyltransferase 1, chloroplastic from Arabidopsis with 66.48% of identity
• Blastx: Probable homogentisate phytyltransferase 1, chloroplastic from Oryza sativa with 75.15% of identity
• Eggnog: Synthesis of 3-octaprenyl-4-hydroxybenzoate (By similarity)(COG0382)
• Kegg: Link to kegg annotations (AT2G18950)
• CantataDB: -
• Mirbase: gma-MIR5761a (MI0019702)
• Ncbi protein: Link to NCBI protein (XP_019463006.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;