Transcript | Ll_transcript_435889 |
---|---|
CDS coordinates | 957-1442 (+) |
Peptide sequence | MSSVISKMGFLFLEQGFNKLLVPMCLIISLFSSGTGFYYQTRGLKHGRAIVVSTCAAVASIMTGVLAGMLALGERLPSVPKARLLLLLGWLLIIAGVILLVGSARLMRLLKFPSHRFRRSRADKNYGHRRSGSSRIREPSPTAVIHAATLNNLLSSSKEKA* |
ORF Type | complete |
Blastp | Probable magnesium transporter NIPA9 from Arabidopsis with 62.11% of identity |
---|---|
Blastx | Probable magnesium transporter NIPA9 from Arabidopsis with 62.11% of identity |
Eggnog | Pfam:DUF803(ENOG41124JW) |
Kegg | Link to kegg annotations (AT5G11960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415858.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer