Protein coding transcript 64479

• Transcript: Ll_transcript_435889
• CDS coordinates: 957-1442 (+)
• Peptide sequence: MSSVISKMGFLFLEQGFNKLLVPMCLIISLFSSGTGFYYQTRGLKHGRAIVVSTCAAVASIMTGVLAGMLALGERLPSVPKARLLLLLGWLLIIAGVILLVGSARLMRLLKFPSHRFRRSRADKNYGHRRSGSSRIREPSPTAVIHAATLNNLLSSSKEKA*
• ORF Type: complete

Annotations of Ll_transcript_435889

• Blastp: Probable magnesium transporter NIPA9 from Arabidopsis with 62.11% of identity
• Blastx: Probable magnesium transporter NIPA9 from Arabidopsis with 62.11% of identity
• Eggnog: Pfam:DUF803(ENOG41124JW)
• Kegg: Link to kegg annotations (AT5G11960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415858.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;