Transcript | Ll_transcript_437664 |
---|---|
CDS coordinates | 1440-2390 (+) |
Peptide sequence | MSLGQKIKVSTVHSMAVLSRSEPPSSGSLNPALGDTMKQLLSFLSDNKSPFTINPYPIFAYQSDPRPETLAFCLFHPNAGRVDNGNGKLYTNMFDAQVDAVYSALSAMGFQDIEIVVAETGWPSRGDTNEVGPSVENAKAYNGNLITHLRSLVGTPLMPAKSVDTYIFALYDEDLKPGPASERAFGLFKTDLTMSYDVALAKSSQQPQAPSTSPTTPVTPAPSTAAQWCVPKVGVSDVQLQANMDYACSQGIDCSPIQAGGACFEPNIVASHAAFAMNLYYQKFGKNPWNCDFSQSATLTAQNPSYNACVYPGGST* |
ORF Type | complete |
Blastp | Glucan endo-1,3-beta-D-glucosidase from Olea with 67.83% of identity |
---|---|
Blastx | Glucan endo-1,3-beta-D-glucosidase from Olea with 67.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416483.1) |
Pfam | Glycosyl hydrolases family 17 (PF00332.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer