Protein coding transcript 64549

• Transcript: Ll_transcript_437647
• CDS coordinates: 133-612 (+)
• Peptide sequence: MAYQGPASGSSSTSGFQQMNSPFGDTTYTKLFVGGLAWETQTETMRRYFHQFGHILEAVVITDKNTGRSKGYGFVTFRDPEAARRACADSAPTIDGRRANCNLASLGRPHPPLPYERIRVASPYIGSLQPARGAYVGGYGYQQPVPYNYQQGLVYPPYG*
• ORF Type: complete

Annotations of Ll_transcript_437647

• Blastp: Probable RNA-binding protein ARP1 from Arabidopsis with 65.93% of identity
• Blastx: Probable RNA-binding protein ARP1 from Arabidopsis with 65.93% of identity
• Eggnog: RNA binding motif protein(ENOG4111PGT)
• Kegg: Link to kegg annotations (AT3G54770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414871.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;