Protein coding transcript 64631

• Transcript: Ll_transcript_435735
• CDS coordinates: 974-1528 (+)
• Peptide sequence: MIRHKMNQPGKSLGVIGLGGLGHMAVKFGKAFGLNVTILSSSISKKEEALNLLGADKFVLSSDPEQMKASAKSLDFIIDTASGDHPFDPYMSLMKTYGVFVLVGFPSVIKFSPGNLNIGMKTISGSITGGTKDIQEMIDFCAEKEIYPNIEVIPIDYANEALERVVKKDVKYRFVIDIENSLRA*
• ORF Type: complete

Annotations of Ll_transcript_435735

• Blastp: Probable cinnamyl alcohol dehydrogenase 1 from Arabidopsis with 75% of identity
• Blastx: Probable cinnamyl alcohol dehydrogenase 1 from Arabidopsis with 76.3% of identity
• Eggnog: alcohol dehydrogenase(COG1064)
• Kegg: Link to kegg annotations (AT1G72680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020969759.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;