Transcript | Ll_transcript_435741 |
---|---|
CDS coordinates | 896-1450 (+) |
Peptide sequence | MIRHKMNQPGKSLGVIGLGGLGHMAVKFGKAFGLNVTILSSSISKKEEALNLLGADKFVLSSDPEQMKASAKSLDFIIDTASGDHPFDPYMSLMKTYGVFVLVGFPSVIKFSPGNLNIGMKTISGSITGGTKDIQEMIDFCAEKEIYPNIEVIPIDYANEALERVVKKDVKYRFVIDIENSLRA* |
ORF Type | complete |
Blastp | Probable cinnamyl alcohol dehydrogenase 1 from Arabidopsis with 75% of identity |
---|---|
Blastx | Probable cinnamyl alcohol dehydrogenase 1 from Arabidopsis with 76.3% of identity |
Eggnog | alcohol dehydrogenase(COG1064) |
Kegg | Link to kegg annotations (AT1G72680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020969759.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer