| Transcript | Ll_transcript_437989 |
|---|---|
| CDS coordinates | 22-327 (+) |
| Peptide sequence | MAKPFVLSFSLCLLLFSSVCLAERPERFKECQLDKLNALEPDNRIESEGGVTETWNSSRPELRCAGVAFEKHTIQPQGLHLPSYTNYPQLIFIVEGEGALGI |
| ORF Type | 3prime_partial |
| Blastp | Legumin type B from Vicia with 58.65% of identity |
|---|---|
| Blastx | Legumin J from Pisum with 61.04% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019429051.1) |
| Pfam | Cupin (PF00190.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer