Transcript | Ll_transcript_437998 |
---|---|
CDS coordinates | 180-602 (+) |
Peptide sequence | MASSSSTTMTISPRKLHYDLYSFSYQEDSNTPLVINVLASLIERSMTRTKRIEKNYSSSVFSKAKNTNMFDSKEIPDMTIESYLERIFKYTRAGPSVYVVAYVYIDRFCHNNPGFWINVTNVHRLLITTIMVASKYVEDM* |
ORF Type | complete |
Blastp | Cyclin-U2-1 from Arabidopsis with 70.9% of identity |
---|---|
Blastx | Cyclin-U2-1 from Arabidopsis with 72.09% of identity |
Eggnog | Cyclin-dependent protein kinase(ENOG4111TTK) |
Kegg | Link to kegg annotations (AT2G45080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446963.1) |
Pfam | Cyclin (PF08613.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer