Protein coding transcript 64729

• Transcript: Ll_transcript_437548
• CDS coordinates: 149-955 (+)
• Peptide sequence: MQNYESSFGFLNSNMLRISNSETNNTLSSSEIITINDYLQPKQQVPIRNSLVMPQISFSKPPRPSSNLSKRKPSLNITIPSITSTNFTTFLQHKETQICNQTSSDNSDVTKEEKHYRGVRRRPWGKFAAEIRDPNKKGTRVWLGTFDTAIEAAKAYDRAAFNMRGSKAILNFPLEVEININSQQESLLVGNKRRRDEDGEVVNDKKVKKEEKCLSPKAKSVTVCTPLTPSCWKGFWDNHDIMGTIFSVPPLSPSSPLMVLSCYGLLSS*
• ORF Type: complete

Annotations of Ll_transcript_437548

• Blastp: Ethylene-responsive transcription factor 5 from Nicotiana with 53.23% of identity
• Blastx: Ethylene-responsive transcription factor 5 from Nicotiana with 48.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107790518)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435558.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;