Protein coding transcript 6478

• Transcript: Ll_transcript_495428
• CDS coordinates: 37-450 (+)
• Peptide sequence: MAIFMNKIVLSSFMLATIFFTLMVGVESAFDFFKVKVVVTNMISLNQLTVHCKDKTHDDGSNTLKPGESHRFKFVPDPFGFASLWFCSFNWTGASHNFDIFVEKRDINCLNDICLWDIYASGPCKIDKEMTCYPWNS*
• ORF Type: complete

Annotations of Ll_transcript_495428

• Blastp: S-protein homolog 2 from Arabidopsis with 42.98% of identity
• Blastx: S-protein homolog 2 from Arabidopsis with 42.98% of identity
• Eggnog: Plant self-incompatibility protein S1(ENOG410ZGCR)
• Kegg: Link to kegg annotations (AT4G16195)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013467042.1)
• Pfam: Plant self-incompatibility protein S1 (PF05938.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;