Protein coding transcript 64867

• Transcript: Ll_transcript_437741
• CDS coordinates: 3-449 (+)
• Peptide sequence: CVALAWIIPSAVNKILWSRLQQQEHWTALALMWKTTPITLIFLAAMIPWLDPPGVLSFDWNISNMLVILSSAILGFLLQWSGALALGATSPLSHVVLGQFKTCVILLGNYYLFGSNPGISSIFGACTAIAGMSVYTYLNLKLHSNKIFP
• ORF Type: internal

Annotations of Ll_transcript_437741

• Blastp: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 73.05% of identity
• Blastx: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 73.05% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462608.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;