Protein coding transcript 64868

• Transcript: Ll_transcript_437742
• CDS coordinates: 3-416 (+)
• Peptide sequence: CVALAWIIPSAVNKILWSRLQQQEHWTALALMWKTTPITLIFLAAMIPWLDPPGVLSFDWNFSNTFVILSSAILGFLLQWSGALALGATSPLSHVVLGQFKTCIILLGNYYLFGSNPGIVSIFGACTAIAGHMVLFN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_437742

• Blastp: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 74.05% of identity
• Blastx: Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 74.05% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454777.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;