| Transcript | Ll_transcript_437723 |
|---|---|
| CDS coordinates | 496-792 (+) |
| Peptide sequence | MFNFLLTNDVKKILKRKDSDAGETGRALEDFRASLFNEFRSSEGVKRQQRTSGPAAALFFNFLVAVGIIFMNKMVLQTVQFKFPILLSLIHYAVSWLLM |
| ORF Type | 3prime_partial |
| Blastp | Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 64.08% of identity |
|---|---|
| Blastx | Nucleotide-sugar uncharacterized transporter 1 from Arabidopsis with 64.42% of identity |
| Eggnog | solute carrier family 35 member(ENOG410XP1S) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019462608.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer