Protein coding transcript 64895

• Transcript: Ll_transcript_436943
• CDS coordinates: 124-450 (+)
• Peptide sequence: MTSSSASSRKNLSKIACNRLQKELVEWQVNPPTGFNHKVTDNLQRWVIEVTGAPGTLYTNETYQLQVDFPENYPMEAPQVIFLNPAPMHPHIYSNGHICLGMYGVSRC*
• ORF Type: complete

Annotations of Ll_transcript_436943

• Blastp: Probable ubiquitin-conjugating enzyme E2 16 from Arabidopsis with 83.33% of identity
• Blastx: Probable ubiquitin-conjugating enzyme E2 16 from Arabidopsis with 83.33% of identity
• Eggnog: ubiquitin-conjugating enzyme(COG5078)
• Kegg: Link to kegg annotations (AT1G75440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422424.1)
• Pfam: Ubiquitin-conjugating enzyme (PF00179.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;