Transcript | Ll_transcript_435700 |
---|---|
CDS coordinates | 1312-1719 (+) |
Peptide sequence | MMSMRIRDKARRFITLIDELYNRHCCLCCLASSSVDELFQGTEEGTLFDLESFQFETETEGAKLRRDVLAEGNVGSGGGPVGITSILSGQEEMFAFQRAVSRLIEMQTPLYLDGISNFHPFFQRQHYKLLSESSI* |
ORF Type | complete |
Blastp | AFG1-like ATPase from Mus with 36.7% of identity |
---|---|
Blastx | AFG1-like ATPase from Mus with 38.35% of identity |
Eggnog | AFG1 family ATPase(COG1485) |
Kegg | Link to kegg annotations (215951) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447543.1) |
Pfam | AFG1-like ATPase (PF03969.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer