Protein coding transcript 64995

• Transcript: Ll_transcript_436685
• CDS coordinates: 217-708 (+)
• Peptide sequence: MGSMRMGGCLSLIICVLLLLKAEAISVSISFVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWIVHVEGGGWCNNVTTCLARKDTRLGSSKKMDGVVSFSGFFSNKQKFNPDFYDWNRIKVRYCDGASFTGDIEAVDPATNLHFRGARVFVAVIEELLAKGMKN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_436685

• Blastp: Pectin acetylesterase 8 from Arabidopsis with 67.74% of identity
• Blastx: Pectin acetylesterase 8 from Arabidopsis with 71.33% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT4G19420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421190.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;