Transcript | Ll_transcript_330399 |
---|---|
CDS coordinates | 1664-2101 (+) |
Peptide sequence | MWSTFLESVPDNEWSMTKIVNTLVSNREYADKMLTYAENYNQSISRRRSFAEILFGELDEHSHHYKESLLTGSSLHKMIRLITLTIGGRAYLNFMGNEFGHPKGVEFPASSNNFSYSLANRQWDLLGKEVNHDLFSFDKDMMKLDK |
ORF Type | 3prime_partial |
Blastp | 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic from Arabidopsis with 72.6% of identity |
---|---|
Blastx | 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic from Arabidopsis with 73.63% of identity |
Eggnog | Catalyzes the formation of the alpha-1,6-glucosidic linkages in glycogen by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position (By similarity)(COG0296) |
Kegg | Link to kegg annotations (AT3G20440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440691.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer