Protein coding transcript 65148

• Transcript: Ll_transcript_330388
• CDS coordinates: 1417-1926 (+)
• Peptide sequence: MIYSHNGFATFTGDLEEYCNQYVDKDALLYLILANEILHFFYPNIITIAEDATFYPGLCEPVSQGGLGFDYYVNLSVSEMWSTFLESVPDNEWSMTKIVNTLVSNREYADKMLTYAENYNQSISRRRSFAEILFGELDEHSHHYKESLLTGSSLHKVCCSLISIVFLFS*
• ORF Type: complete

Annotations of Ll_transcript_330388

• Blastp: 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic from Arabidopsis with 75.8% of identity
• Blastx: 1,4-alpha-glucan-branching enzyme 3, chloroplastic/amyloplastic from Arabidopsis with 64.52% of identity
• Eggnog: Catalyzes the formation of the alpha-1,6-glucosidic linkages in glycogen by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position (By similarity)(COG0296)
• Kegg: Link to kegg annotations (AT3G20440)
• CantataDB: Link to cantataDB annotations (CNT0000755)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440691.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;