Protein coding transcript 65161

• Transcript: Ll_transcript_332400
• CDS coordinates: 1470-1880 (+)
• Peptide sequence: MVLNFIIHCEFFVQETEEMIADVLGVEVFRQTVAGNILVGSYCAFSNRGGLVHPHTSIEDLDELSTLLQVPLVAGTVNRGSEVIAAGMTVNDWTAFCGSDTTATELSVIESVFKLREAQPSAIVDEMRKSLIDSYV*
• ORF Type: complete

Annotations of Ll_transcript_332400

• Blastp: Eukaryotic translation initiation factor 6-2 from Arabidopsis with 89.43% of identity
• Blastx: Eukaryotic translation initiation factor 6-2 from Arabidopsis with 89.43% of identity
• Eggnog: Binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit to form the 80S initiation complex in the cytoplasm(COG1976)
• Kegg: Link to kegg annotations (AT3G55620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016204100.1)
• Pfam: eIF-6 family (PF01912.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;