Protein coding transcript 65242

• Transcript: Ll_transcript_330693
• CDS coordinates: 1-369 (+)
• Peptide sequence: YYMPYTNLKSILKIVDFLQMDARNLAMEIAPIIMWQKDQRPEFYSQYLNHMSKSPSKRSLDPPPGSDSNFDMLADDGEAIVASSPIPLDDDTPVDFGAIEVVQLLIEHHNAIFTDANETVWR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_330693

• Blastp: Uncharacterized Rho GTPase-activating protein At5g61530 from Arabidopsis with 59.62% of identity
• Blastx: Uncharacterized Rho GTPase-activating protein At5g61530 from Arabidopsis with 59.62% of identity
• Eggnog: rho GTPase activating protein(ENOG410XRR2)
• Kegg: Link to kegg annotations (AT5G61530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413910.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;