Transcript | Ll_transcript_329688 |
---|---|
CDS coordinates | 133-438 (+) |
Peptide sequence | MDHDGIDGIVDKQIVENCNIEEVRQLAKIAHKCLHKSPRRRPSIGEVSQTISWIKQRRQQRHATGESMSFASNDFSRAVSRLEDRQVELSRIAIMDLKENG* |
ORF Type | complete |
Blastp | Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 52.58% of identity |
---|---|
Blastx | Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 52.53% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G15730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442768.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer