Protein coding transcript 65398

• Transcript: Ll_transcript_329691
• CDS coordinates: 1126-1626 (+)
• Peptide sequence: MRAKVSDFGLSKEEVFDGKNSGLKGTYGYIDPAYISTSKFTMKSDIYSFGIIIFELITAIHPHQNLLEYVSLAAMDHDGIDGILDKQLVENCNIEEVRQLAIIAHRCLHKSPKKRPSIGEVSQVMSRINRRQQHRSIENLSGGLSQLEDQHDELSRTASMNHKQNE*
• ORF Type: complete

Annotations of Ll_transcript_329691

• Blastp: Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 59.44% of identity
• Blastx: Calcium/calmodulin-regulated receptor-like kinase 1 from Arabidopsis with 63.45% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442768.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;