Protein coding transcript 65400

• Transcript: Ll_transcript_329693
• CDS coordinates: 306-785 (+)
• Peptide sequence: MNLHANIITSGIITGLVLGILISCLIFFGIRCYKKCSKFTRSSSGSTSTTLPIRANGLGASTDFSASITSSISMSISMKNSSPFSCWSCQSKDRLASPSGIPKYSYKEIQRATQNFTTTLGQGSFGTVYKATMGTGEVVAVKVLATNSKQGEKEFQTEV*
• ORF Type: complete

Annotations of Ll_transcript_329693

• Blastp: Calcium/calmodulin-regulated receptor-like kinase 1 from Arabidopsis with 48.32% of identity
• Blastx: Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 58.54% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G54590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452984.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;