Protein coding transcript 65401

• Transcript: Ll_transcript_329695
• CDS coordinates: 233-718 (+)
• Peptide sequence: MVHQADLVIIGVTVGLALGILISCLIFFGIRWYKKHANIRRPANENSLTTLPIRTNGLETSTDFSASITSSMGMSISENVHQNSHFSWWSHQSKDRFTSPSGIPKYSYKEIQKATQNFTTTLGQGSFGTVYKATMPAGEVVAVKVLAPNSKQGEKEFQTEV*
• ORF Type: complete

Annotations of Ll_transcript_329695

• Blastp: Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 52.15% of identity
• Blastx: Calcium/calmodulin-regulated receptor-like kinase 2 from Arabidopsis with 52.15% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442768.1)
• Pfam: ABC1 family (PF03109.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;