Transcript | Ll_transcript_331865 |
---|---|
CDS coordinates | 100-609 (+) |
Peptide sequence | MEDIKHRIIEVNGINMHVAEKGQGPIVLFLHGFPELWYSWRHQILSLSSQGYHAVAPDLRGYGDTDAPPSVTSYTCFHIVGDIVALIDSLGVDQVFLVAHDWGALIGWYLCLFRPDRVKAYVCLSVPYLRRNPKVKTVDGMRAMYGDNYYICRFQVLVFLRFKILFRFF* |
ORF Type | complete |
Blastp | Epoxide hydrolase A from Mycobacterium tuberculosis complex with 41.77% of identity |
---|---|
Blastx | Epoxide hydrolase A from Mycobacterium tuberculosis complex with 42.48% of identity |
Eggnog | Hydrolase(ENOG410XVV6) |
Kegg | Link to kegg annotations (Rv3617) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422885.1) |
Pfam | alpha/beta hydrolase fold (PF00561.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer