Protein coding transcript 65448

• Transcript: Ll_transcript_332027
• CDS coordinates: 830-1750 (+)
• Peptide sequence: MSEESIWPMLAQESLKALGGLGLLSFGTKYILRRVFEVVAETRSSEAFVALCLLTVAGTSLITQHLGFSDTLGAFLAGAILAETNFRTQIEADIRPFRGLLLGLFFLTTGTSIDMQILLREWPNVLALLAGLIAIKTLIITAIGPRVGLTLQESVRIGLLLSQGGEFGFVVFSLANRLGVLPLELNKLLIIVVVLSMALTPFLNEAGRRASSFIDDKSDAENKASEAVNFDASEPVVILGFGQMGQVLANFLGNPLASRGDSGAMGWPYVAFDLDHKVVKVSASEHCAWLLSAYDTFSEELFEIHE*
• ORF Type: complete

Annotations of Ll_transcript_332027

• Blastp: K(+) efflux antiporter 3, chloroplastic from Arabidopsis with 79.57% of identity
• Blastx: K(+) efflux antiporter 3, chloroplastic from Arabidopsis with 76.53% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT4G04850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421720.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;