Transcript | Ll_transcript_331456 |
---|---|
CDS coordinates | 2061-2924 (+) |
Peptide sequence | MVQMEWSQPQIQGDLVSPRAGHAGITVDGSWFIVGGGDNKSGCPETLVLNMSKLVWSVLTVVKQKDPLSSEGLSVCSALIDGEKYLLAFGGYNGRYSNEVFVLRPKARDFLRPKIFQSPAAAAAAASVSSAYALSKSEKLDFMQLDDINSKPSVNGHPLDDVTVKSEAIKEEKRLLELSIAEVRAENSRLRDEINEVNSTHTELTKELQSVQGQLLGERSRCVNLEAKIAELQNMLESMQSVEDQARALRNQKSALDQETEHAATVQRQSSGGVWRWLGGGGESDAN* |
ORF Type | complete |
Blastp | Acyl-CoA-binding domain-containing protein 4 from Arabidopsis with 42.61% of identity |
---|---|
Blastx | Acyl-CoA-binding domain-containing protein 5 from Arabidopsis with 47.22% of identity |
Eggnog | Kelch domain containing(ENOG410Y5WM) |
Kegg | Link to kegg annotations (AT3G05420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441012.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer