Protein coding transcript 65459

• Transcript: Ll_transcript_331456
• CDS coordinates: 2061-2924 (+)
• Peptide sequence: MVQMEWSQPQIQGDLVSPRAGHAGITVDGSWFIVGGGDNKSGCPETLVLNMSKLVWSVLTVVKQKDPLSSEGLSVCSALIDGEKYLLAFGGYNGRYSNEVFVLRPKARDFLRPKIFQSPAAAAAAASVSSAYALSKSEKLDFMQLDDINSKPSVNGHPLDDVTVKSEAIKEEKRLLELSIAEVRAENSRLRDEINEVNSTHTELTKELQSVQGQLLGERSRCVNLEAKIAELQNMLESMQSVEDQARALRNQKSALDQETEHAATVQRQSSGGVWRWLGGGGESDAN*
• ORF Type: complete

Annotations of Ll_transcript_331456

• Blastp: Acyl-CoA-binding domain-containing protein 4 from Arabidopsis with 42.61% of identity
• Blastx: Acyl-CoA-binding domain-containing protein 5 from Arabidopsis with 47.22% of identity
• Eggnog: Kelch domain containing(ENOG410Y5WM)
• Kegg: Link to kegg annotations (AT3G05420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441012.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;