Transcript | Ll_transcript_332219 |
---|---|
CDS coordinates | 856-2061 (+) |
Peptide sequence | MGSFSGDEECEFFDAVEDIVSIADEKLDGKNSDSNAKEGMSNGFDYDLWIRKPRSVRERRSMFMQRMGLRVTENGVTNSVDMGGGGGVEGEKMNNSVNDSDGVVDRNCGFEEEFCSSRSSVSCWPTLNSSQEFGVMENLPCHLDQEGQDRKMSDGGRDRDSDRSVVAEELEDSKNTFQRLTSREFEEIDADALSKKSNRPVRAWLRRLQSITCMRDKQSESEKEQGDSCAFSGCRLQKVKVRQCKKQMKELSALYMRQDIQAHEGSILTMKFSSDGQYLASAGEDGVVRVWQVVVDDRCNEIDIPEIDPSCIYFTVNDLSELRPLFMDKEKLTKVKGLKKTSDSACIIFPPKIFRLLEKPLHEFHGHTGEVLDISWSKNNVSECHNFSYLLNFELDIHFGI* |
ORF Type | complete |
Blastp | WD repeat-containing protein YMR102C from Saccharomyces with 25.88% of identity |
---|---|
Blastx | WD repeat-containing protein 44 from Homo with 35.59% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YMR102C) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415404.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer