Protein coding transcript 65601

• Transcript: Ll_transcript_330084
• CDS coordinates: 2909-3268 (+)
• Peptide sequence: MSNLQAAYAAAFKNTRPSAEDIPEDLALIVTSCWKEDPKERPNFTEIIQMLLRYLCTISPSMSVAPLQRMTSSENAVLPPESPGTRALMATRDDSIETPKAANMEDRPKGFLFCFNHCY*
• ORF Type: complete

Annotations of Ll_transcript_330084

• Blastp: Serine/threonine-protein kinase HT1 from Arabidopsis with 31.71% of identity
• Blastx: Probable serine/threonine-protein kinase DDB_G0267514 from Dictyostelium with 40.7% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G62400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442512.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;