Transcript | Ll_transcript_330679 |
---|---|
CDS coordinates | 2-1573 (+) |
Peptide sequence | SFKTMVIFSSVISKHAADIVTTETQYGREPRFKTSELSANFLSFSLQSNCGICLNSVKTGKGTAIYTAECSHTFHFPCIASHVRNHGSLVCPVCNATWKDVPLLVAHKNENDIVAIEKMRTESSSSVSKINHVQPPQQKHVSDSVRSYDDDEPLLSPRFVPIPEADENGDEEQQQNDDVEFQGFFVDPKPSSSVKSFSDERQINDGDSRTVEVKLMPECAIVSVSRSHESYALVLKVKAPPPPPPPLIRSGGAPILDPSQRAPIDLVTVLGIGGSMTGAKLEMLKRSMRLVISSLGSSDRLSIVAFSAIPKRLLPLRRMTPQGQRMARRIVDRLVSVTGNGTTSVGDALRKATKVLEDRRERNPVASVMLLSDGQDERAETGNKSNQRKNVSHVSSTRFAHIEIPVQSFGLGRTQSGEEDTFAKCVGGILSVVVQDLRIQLGFQSDSGEIIAVYSCSGRPTLLSSGAVRLGDLYAEEERDLLIELRVPSSCFQNGTHHMKWGKEVARLIIEKVPTRNRAKMIF* |
ORF Type | 5prime_partial |
Blastp | Inter-alpha-trypsin inhibitor heavy chain H4 from Sus with 29.85% of identity |
---|---|
Blastx | Inter-alpha-trypsin inhibitor heavy chain H4 from Sus with 29.85% of identity |
Eggnog | von Willebrand factor, type A(COG2304) |
Kegg | Link to kegg annotations (396799) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425748.1) |
Pfam | RING-like zinc finger (PF17123.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer