Transcript | Ll_transcript_330995 |
---|---|
CDS coordinates | 1428-1853 (+) |
Peptide sequence | MYVGPALLIDVPKDKNITAEVMKSLNIPRGVNRVLFRTLNTDRRLMFKKDWDTSYVGFMEDGAKWLVENTDIKLVGIDYLSVAAYDDLIPSHLVFLKDREIILVEALKLDDVPAGTYSVHCLPLRLAGAEGSPIRCILIKI* |
ORF Type | complete |
Blastp | Kynurenine formamidase from Bacillus cereus group with 34.29% of identity |
---|---|
Blastx | Kynurenine formamidase from Bacillus cereus group with 34.29% of identity |
Eggnog | Cyclase family(COG1878) |
Kegg | Link to kegg annotations (BC2758) |
CantataDB | Link to cantataDB annotations (CNT0002769) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453041.1) |
Pfam | Putative cyclase (PF04199.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer