Protein coding transcript 65740

• Transcript: Ll_transcript_331270
• CDS coordinates: 63-581 (+)
• Peptide sequence: MSSWSSTCSSLHEVTNTKKKLKGVRRRKWGKWVSEIRVPGTQERLWLGTYATAEAAAVAHDVAVYCLRKPSSLSMEKLNFPQTLSSYGVENRNDMSPKSIQKVASDVGMDVDARNIAGKTTKVVVEQTKYEKKNGDEDECDLFWWENLGGDSQGSEEDREGEGLSISVEDYL*
• ORF Type: complete

Annotations of Ll_transcript_331270

• Blastp: Ethylene-responsive transcription factor ERF020 from Arabidopsis with 66.67% of identity
• Blastx: Ethylene-responsive transcription factor ERF020 from Arabidopsis with 66.67% of identity
• Eggnog: Transcription factor(ENOG410YYQ2)
• Kegg: Link to kegg annotations (AT1G71520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444617.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;