| Transcript | Ll_transcript_331223 |
|---|---|
| CDS coordinates | 370-714 (+) |
| Peptide sequence | MRNQLEACASLKGEQVAARVTPRNAVKDEWFVVKVIHFEKESKEFEVLDEEPGDDEDSSGQRQYKLPMGNIIPFPKSNDPSSAPDFPPGKHVLAVYPGTTALYKATVVHGHRKL* |
| ORF Type | complete |
| Blastp | SAGA-associated factor 29 from Mus with 33% of identity |
|---|---|
| Blastx | - |
| Eggnog | SAGA-associated factor 29(ENOG410XPFD) |
| Kegg | Link to kegg annotations (75565) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447449.1) |
| Pfam | SGF29 tudor-like domain (PF07039.10) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer