Transcript | Ll_transcript_331251 |
---|---|
CDS coordinates | 117-821 (+) |
Peptide sequence | MSSPDIAAILENSKELDRLRKDQEEILLEINKLHKKLQTTPEVVEKPGDNSLARLKVLYTQAKDLSDSEANISNLLITQLDAILPPGPQGQPRRRIGKEGNEQKRKRVKTDSDISRLTSSMRNQLEACASLKGEQVAARVTPRNAVKDEWFVVKVIHFEKESKEFEVLDEEPGDDEDSSGQRQYKLPMGNIIPFPKSNDPSSAPDFPPGKHVLAVYPGTTALYKATVVHGHRKL* |
ORF Type | complete |
Blastp | SAGA-associated factor 29 from Mus with 27.31% of identity |
---|---|
Blastx | - |
Eggnog | SAGA-associated factor 29(ENOG410XPFD) |
Kegg | Link to kegg annotations (75565) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447449.1) |
Pfam | SGF29 tudor-like domain (PF07039.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer