Protein coding transcript 65754

• Transcript: Ll_transcript_331256
• CDS coordinates: 370-825 (+)
• Peptide sequence: MRNQLEACASLKGEQVAARVTPRNAVKDEWFVVKVIHFEKESKEFEVLDEEPGDDEDSSGQRQYKLPMGNIIPFPKSNDPSSAPDFPPGKHVLAVYPGTTALYKATVVHGHRKRKTDDYVLEFDDDEEDGSLPQRTVPFHKVVPMPEGHRP*
• ORF Type: complete

Annotations of Ll_transcript_331256

• Blastp: SAGA-associated factor 29 from Homo with 31.65% of identity
• Blastx: SAGA-associated factor 29 from Homo with 31.65% of identity
• Eggnog: SAGA-associated factor 29(ENOG410XPFD)
• Kegg: Link to kegg annotations (112869)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447449.1)
• Pfam: SGF29 tudor-like domain (PF07039.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;