Protein coding transcript 65758

• Transcript: Ll_transcript_331233
• CDS coordinates: 117-932 (+)
• Peptide sequence: MSSPDIAAILENSKELDRLRKDQEEILLEINKLHKKLQTTPEVVEKPGDNSLARLKVLYTQAKDLSDSEANISNLLITQLDAILPPGPQGQPRRRIGKEGNEQKRKRVKTDSDISRLTSSMRNQLEACASLKGEQVAARVTPRNAVKDEWFVVKVIHFEKESKEFEVLDEEPGDDEDSSGQRQYKLPMGNIIPFPKSNDPSSAPDFPPGKHVLAVYPGTTALYKATVVHGHRKRKTDDYVLEFDDDEEDGSLPQRTVPFHKVVPMPEGHRP*
• ORF Type: complete

Annotations of Ll_transcript_331233

• Blastp: SAGA-associated factor 29 from Gallus with 28.14% of identity
• Blastx: SAGA-associated factor 29 from Gallus with 26.62% of identity
• Eggnog: SAGA-associated factor 29(ENOG410XPFD)
• Kegg: Link to kegg annotations (424726)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447449.1)
• Pfam: SGF29 tudor-like domain (PF07039.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;