Transcript | Ll_transcript_331250 |
---|---|
CDS coordinates | 496-951 (+) |
Peptide sequence | MRNQLEACASLKGEQVAARVTPRNAVKDEWFVVKVIHFEKESKEFEVLDEEPGDDEDSSGQRQYKLPMGNIIPFPKSNDPSSAPDFPPGKHVLAVYPGTTALYKATVVHGHRKRKTDDYVLEFDDDEEDGSLPQRTVPFHKVVPMPEGHRP* |
ORF Type | complete |
Blastp | SAGA-associated factor 29 from Homo with 31.65% of identity |
---|---|
Blastx | SAGA-associated factor 29 from Homo with 31.65% of identity |
Eggnog | SAGA-associated factor 29(ENOG410XPFD) |
Kegg | Link to kegg annotations (112869) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447449.1) |
Pfam | SGF29 tudor-like domain (PF07039.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer