Protein coding transcript 65764

• Transcript: Ll_transcript_331248
• CDS coordinates: 255-785 (+)
• Peptide sequence: MAKVAFCDFRFLLLIAAAVFIYIQMRLFATQSQYADRLAAAIEAENHCTSQMRSLIDQISLQQGRIVSLEQETTRRDQECGQIKSLLQHHRRKDLHRLIDQVQVPVAAVLIMACNRADYLQRTINSVLKYQSPISSRYPLFVSQDGSNPDVKSKALSYDQLSYIQVFITIMIKSRC*
• ORF Type: complete

Annotations of Ll_transcript_331248

• Blastp: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase from Arabidopsis with 61.82% of identity
• Blastx: Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase from Arabidopsis with 61.82% of identity
• Eggnog: mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase(ENOG410XQD8)
• Kegg: Link to kegg annotations (AT4G38240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417333.1)
• Pfam: GNT-I family (PF03071.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;