Transcript | Ll_transcript_331236 |
---|---|
CDS coordinates | 1499-2197 (+) |
Peptide sequence | MEIAPDFFDYFEATAALLDKDKSIMAVSSWNDNGQKQFVHDPYELHRSDFFPGLGWMLARPTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRTYNFGEHGSSMGQFFKQYLEPIKLNEVQVDWKSVDLSYLLEDKYTMHFANIVDKAKPVYGADMVLKAYNIDGDVRIKYKDQSDFENIARQFGIFEEWKDGVPRTAYKGVVVFRYQTKRIFLVGPESLKQLQIKDF* |
ORF Type | complete |
Blastp | Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase from Arabidopsis with 78.02% of identity |
---|---|
Blastx | Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase from Arabidopsis with 77.99% of identity |
Eggnog | mannosyl (alpha-1,3-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase(ENOG410XQD8) |
Kegg | Link to kegg annotations (AT4G38240) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417333.1) |
Pfam | GNT-I family (PF03071.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer