| Transcript | Ll_transcript_331923 |
|---|---|
| CDS coordinates | 100-432 (+) |
| Peptide sequence | MAFANKFLALLIFSLVIISMLQTLAMASQGHAGQHYDNKSKYGPGSLKSFECPSQCTRRCSQTQYHKPCMFFCQKCCRKCLCVPPGYYGNKAVCPCYNNWKTQQGGPKCP* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | Gibberellin-regulated protein 4 from Arabidopsis with 61.11% of identity |
| Eggnog | Gibberellin-regulated protein(ENOG410YQ6U) |
| Kegg | Link to kegg annotations (AT5G15230) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019432434.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer