Protein coding transcript 65891

• Transcript: Ll_transcript_331907
• CDS coordinates: 125-553 (+)
• Peptide sequence: MGSMYASVIFIGVQNGASVQPVIAVERTVFYRERAAGMYSALPYALAQVIIELPHVLVQTLIYGIIVYAMMGFEWTTTKFLWYLFFMYFTLLYFTFYGMMTMAICPNPHVAGILSSTFYAVWNLFSGFVIPLSVSSNLTSFV*
• ORF Type: complete

Annotations of Ll_transcript_331907

• Blastp: ABC transporter G family member 37 from Oryza sativa with 74.05% of identity
• Blastx: ABC transporter G family member 36 from Oryza sativa with 76.26% of identity
• Eggnog: (ABC) transporter(COG0842)
• Kegg: Link to kegg annotations (4327730)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447532.1)
• Pfam: ABC-2 type transporter (PF01061.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;