| Transcript | Ll_transcript_331936 |
|---|---|
| CDS coordinates | 2657-3022 (+) |
| Peptide sequence | MWTCFLFRIFKRCNIPMVAMGTFPTGLALAIEKKSRRIEISLYCLARAIESFFTCLADEGYLPQSRKIKRADVVVFSLSTAIIMHCYAEEREVFRSKYLNVLDWVFGVPPPPCETPRCKDT* |
| ORF Type | complete |
| Blastp | Transmembrane protein 135 homolog from Caenorhabditis with 32.26% of identity |
|---|---|
| Blastx | - |
| Eggnog | Transmembrane protein 135(ENOG410YP91) |
| Kegg | Link to kegg annotations (CELE_K02G10.3) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019417637.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer