Transcript | Ll_transcript_331936 |
---|---|
CDS coordinates | 2657-3022 (+) |
Peptide sequence | MWTCFLFRIFKRCNIPMVAMGTFPTGLALAIEKKSRRIEISLYCLARAIESFFTCLADEGYLPQSRKIKRADVVVFSLSTAIIMHCYAEEREVFRSKYLNVLDWVFGVPPPPCETPRCKDT* |
ORF Type | complete |
Blastp | Transmembrane protein 135 homolog from Caenorhabditis with 32.26% of identity |
---|---|
Blastx | - |
Eggnog | Transmembrane protein 135(ENOG410YP91) |
Kegg | Link to kegg annotations (CELE_K02G10.3) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417637.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer