Protein coding transcript 65895

• Transcript: Ll_transcript_331937
• CDS coordinates: 1313-2284 (+)
• Peptide sequence: MLLTGLETQHTSLAIYILMRAAVLASRCGIKSKRFGRICKPLTWKHGDIFLMCLSSSQILSAYILKQESLPSSYKSFLNKHGGKDKAILQGVKDIASGKPFTNLEAVEKYYKTVGVNMKLDPNMNVPCSIVHGNQSCTGHIFSFLLQAYKRALPVYLPVYLIPALIVHRQGLLKRPHSILAKGLVGTARSSLFLSVYCTSAWMWTCFLFRIFKRCNIPMVAMGTFPTGLALAIEKKSRRIEISLYCLARAIESFFTCLADEGYLPQSRKIKRADVVVFSLSTAIIMHCYAEEREVFRSKYLNVLDWVFGVPPPPCETPRCKDT*
• ORF Type: complete

Annotations of Ll_transcript_331937

• Blastp: Transmembrane protein 135 homolog from Caenorhabditis with 32.26% of identity
• Blastx: Transmembrane protein 135 homolog from Caenorhabditis with 32.95% of identity
• Eggnog: Transmembrane protein 135(ENOG410YP91)
• Kegg: Link to kegg annotations (CELE_K02G10.3)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417637.1)
• Pfam: N-terminal cysteine-rich region of Transmembrane protein 135 (PF15982.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;