Protein coding transcript 65896

• Transcript: Ll_transcript_331927
• CDS coordinates: 2874-3335 (+)
• Peptide sequence: MLICRPHSILAKGLVGTARSSLFLSVYCTSAWMWTCFLFRIFKRCNIPMVAMGTFPTGLALAIEKKSRRIEISLYCLARAIESFFTCLADEGYLPQSRKIKRADVVVFSLSTAIIMHCYAEEREVFRSKYLNVLDWVFGVPPPPCETPRCKDT*
• ORF Type: complete

Annotations of Ll_transcript_331927

• Blastp: Transmembrane protein 135 homolog from Caenorhabditis with 32.26% of identity
• Blastx: Transmembrane protein 135 homolog from Caenorhabditis with 32.26% of identity
• Eggnog: Transmembrane protein 135(ENOG410YP91)
• Kegg: Link to kegg annotations (CELE_K02G10.3)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417637.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;