Transcript | Ll_transcript_330437 |
---|---|
CDS coordinates | 315-635 (+) |
Peptide sequence | MGRGVSSGGGQSSLGYLFGSGEAPAPKPAPSNAQPEVQTVNNAPPSKPVAAPKTIDPNKPAGINSSSIDGLNTGNFITDRPSTKVHAAPGGGSSLGYLFGGPGDAK* |
ORF Type | complete |
Blastp | Protein SPIRAL1-like 2 from Arabidopsis with 63.64% of identity |
---|---|
Blastx | Protein SPIRAL1-like 1 from Arabidopsis with 54.05% of identity |
Eggnog | in maintaining the cortical microtubules organization essential for anisotropic cell growth(ENOG410XU77) |
Kegg | Link to kegg annotations (AT1G69230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428788.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer