Transcript | Ll_transcript_330604 |
---|---|
CDS coordinates | 1983-3239 (+) |
Peptide sequence | MLFGILTISLSLSMPFLSFMDTTYTSPRNGTRKRYVNKYIYIYTHTHAIYIITYSFFSSFFLLLQILFLFSKLCFTKFIMQTWMYVAIPVIIYACERLLRVFRSGYKSVKILKVAVYPGNVLALHVSKPQGFKYSSGQYIFVNCSDVSPFQWHPFSITSAPGDDYVSVHIRTLGDWTSQLKAVFAKACQPSSVDQSGLLRADMLQGNNIPRMPKLMIDGPYGAPAQDYKNYEVILLVGLGIGATPLISILKDVLNNIKQQKDIEEGDVESGVTNNKRKPFATNRAYFYWVTREQGSFEWFKGVMDEVAEYDKDKVIELHNYCTSVYEEGDARSALITMLQSLHHAKNGVDIVSGTRVKTHFAKPNWRSVFKHAAVKHPGKTIGVFYCGAPGLVGELKRLSLDFSRKTNTRFDFHKENF* |
ORF Type | complete |
Blastp | Respiratory burst oxidase homolog protein B from Solanum with 71.16% of identity |
---|---|
Blastx | Respiratory burst oxidase homolog protein B from Solanum with 76.85% of identity |
Eggnog | NADPH Oxidase(ENOG410XNZY) |
Kegg | Link to kegg annotations (102603596) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440572.1) |
Pfam | FAD-binding domain (PF08022.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer